PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462952789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family Nin-like
Protein Properties Length: 879aa    MW: 98129.5 Da    PI: 6.8913
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462952789genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.26.7e-28520571152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+isl+++++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  462952789 520 AEKTISLDVIQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 571
                589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.302510591IPR003035RWP-RK domain
PfamPF020427.6E-25523571IPR003035RWP-RK domain
SuperFamilySSF542776.21E-22760852No hitNo description
SMARTSM006663.0E-20770852IPR000270PB1 domain
PROSITE profilePS5174516.133770852IPR000270PB1 domain
PfamPF005642.2E-14771851IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.8E-22771852No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 879 aa     Download sequence    Send to blast
MGCDDTLECS FSEAVNTKLL LIYELILSGN SETTEIGDYF NGKCQVHLSL VDDYSDSSFF  60
LKQRLTLALR YLKESTNQHL LVQIWAPIRN GGRYIRSTSG QPFVLDQRSI GLLQYRAISM  120
MYTFSTDGDS LQDLGLPGRV FKQRVPEWTP NVQYYRSTEY ARLNHAISYN VHGTVALPVF  180
DPTVKSCIAV LELIMTSTKI NYSSEIDKVC KALETVNLRS TEVIEHPYVQ ICNERHQAAL  240
ADMLEVLTVT CEELKLPLAQ TWVPCKYQNL LTHFSGVKKS CFRAHESCVQ ESCMSASDVA  300
FHVTDARMWG FRDACVAHHL LKGQGVSGKA FILRRPCFSS DVTRFSKMEY DLVHYAHMFG  360
LAGCFSICLQ SAYTGNDDYI LEFFLPPDCR NDDDQKVLLG SILAVLRQHL HSLHVATDDG  420
SNEVCLQVDA ITVIGNEEIE GAHIHHLNFK SGIHASHKSD MHGTKESDSM TIISSTNYER  480
SLLHENEFKC NVSKTTSDFT SDSSFVDINS KHNGRRRGKA EKTISLDVIQ QYFSGSLKNA  540
AKSLGVCPTT MKRICRQHGI SRWPSRQISK VNRSISRLKK VIESVEGPEG AFNLTAITCP  600
VSVPFRQFSS LNKEKGRENK VTEVSIPSAQ ERRGSPSHNK PLESGGLLRT SRPQHPFLAD  660
ISTLVGVEKA SNLRSSSEEP STHSGTSDES CHGSPANNTL DVTLIEPPQN MCKQDELKEE  720
PSQGQNLLFS SLFANGSVSS QHFRNRAISS VTQPTVVPTG NLMSVQNSDI ITVKACYKDD  780
ILRFRFPLSG SFVALKDEVA KRVQMDAGLF DIKYLDDENE WVKLTCDADL AECLDISLLP  840
GTSVLRLFVT DMAIHHMIFL YHPPVRTKQV PESLAIVAK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960682.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3Z3P20.0K3Z3P2_SETIT; Uncharacterized protein
STRINGSi021160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein